Clusterin is an ubiquitously expressed protein of two 40kD chains, alpha and beta, covalently joined by disulfide bonds. It exists in two forms; a pro-apoptotic form localized to the nucleus and a pro-survival secreted form. Both are thought to be involved in DNA repair and cell cycle regulation. The secreted form is thought to inhibit apoptotic signalling by BAX, Clusterin suppression can sensitise cells to chemotherapy. Clusterin is overexpressed in human prostate cancer, breast cancers and squamous cell carcinomas. Part of the SC5b-9 complex, clusterin prevents the binding of a C5b-C7 complex to the membrane of the target cell inhibiting the complement cascade. Clusterin acts as an extracellular chaperone inhibiting the formation of human lysozyme amyloid associated with Alzheimer's disease. Clusterin is also important in spermatogenesis and is secreted by Sertoli cells.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa402-501 from human CLU (NP_001822) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human CLU.