One of the main pathways by which membrane components and proteins are taken into a cell is through clathrin-mediated endocytosis. This pathway leads to the building and formation of clathrin-coated pits, also known as CCVs. Enthoprotin is a highly enriched protein localized on the CCVs, interacting with AP1 and Arf-binding protein 2, both clathrin adaptors. Through the binding of the clathrin heavy chain by its COOH-terminal domain, Enthoprotin induces clathrin production. Abnormalities in the gene encoding for Enthoprotin affect genetic susceptibility to Schizophrenia type I, a highly heritable psychosis. Enthoprotin is expressed throughout tissue types at intermediate to low levels.
Applications
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-261 from ENTH (NP_055481) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ENTH. Species Crossreactivity: mouse and rat.