One of the main pathways by which membrane components and proteins are taken into a cell is through clathrin-mediated endocytosis. This pathway leads to the building and formation of clathrin-coated pits, also known as CCVs. Enthoprotin is a highly enriched protein localized on the CCVs, interacting with AP1 and Arf-binding protein 2, both clathrin adaptors. Through the binding of the clathrin heavy chain by its COOH-terminal domain, Enthoprotin induces clathrin production. Abnormalities in the gene encoding for Enthoprotin affect genetic susceptibility to Schizophrenia type I, a highly heritable psychosis. Enthoprotin is expressed throughout tissue types at intermediate to low levels.

Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.

Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.

GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa161-261 from ENTH (NP_055481) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human ENTH. Species Crossreactivity: mouse and rat.