Forkhead box protein L2 (FOXL2) may function as a transcriptional regulator. FOXL2 is expressed in the nucleus of somatic cells of the developing gonad and and in the follicular cells of the adult ovary. FOXL2 is also expressed in the developing eyelid.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to aa81-113, YQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFI, from human FOXL2, coupled to carrier protein BSA.
Form
Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg sodium azide. Reconstitute with 100ul sterile ddH2O.
Purity
Purified by immunoaffinity chromatography.
Specificity
Recognizes human FOXL2. Predicted length of 376 residues and MW of 39kD.
TDS
NCBI
UniProt
Tech Support
Customer Service
