Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Signal Transduction » Anti -ARFIP2 (ADP Ribosylation Factor Interacting Protein 2, Arfaptin 2, Partner of RAC1, POR1)

Anti -ARFIP2 (ADP Ribosylation Factor Interacting Protein 2, Arfaptin 2, Partner of RAC1,
POR1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
Arfaptin 2, or ADP-ribosylation factor interacting protein 2, is a Rac1 binding protein necessary for Rac-mediated actin polymerization and the subsequent formation of membrane ruffles and lamellipodia.1 Arfaptin-2 has been shown to be involved in interactions between the Rac and ARF signaling pathways.2 Arfaptin 2 also regulates the aggregation of mutant Huntingtin protein by possibly impairing proteasome function. Expression of Arfaptin 2 was shown to be increased at sites of neurodegeneration. Mutant Huntingtin protein is characteristic of Huntington's disease, an inherited neurodegenerative disorder.
Catalog #123469
ApplicationsSuitable for use in ELISA and Western Blot. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
AA Sequence:MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQL
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG2b,k
Clone No2B5
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa1-110 from ARFIP2 (AAH00392) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human ARFIP2.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links