You are here:Home
»
Antibodies
»
Abs to Binding Proteins
»
Anti -ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein, ARF-like 2-binding Protein, Binder of ARF2 Protein 1, BART, BART1)
Anti -ARL2BP (ADP-ribosylation Factor-like 2 Binding Protein, ARF-like 2-binding Protein,
Binder of ARF2 Protein 1, BART, BART1)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B |
|
| ARL2BP is an effector of ADP-ribosylation factor-like 2(ARL2) that is essential for nuclear retention of STAT3. This protein binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. Though predominantly cytosolic, ARL2BP can enter the mitochondria and bind the adenine nucleotide transporter when bound to ARL2. Thus it may also be involved in mitochondria transport and apoptosis. | | | Catalog # | 123528 | | Applications | Suitable for use in ELISA and Western Blot. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH* | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG1,k | | Clone No | 2G6 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Full-length recombinant corresponding to aa1-164 from ARL2BP (AAH03087) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human ARL2BP. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
