BAIAP1 is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. Characterized by two WW domains, a guanylate kinase domain, and five PDZ domains, this protein interacts with the cytoplasmic region of BAI1. Together, these proteins may play a role in cell adhesion and signal transduction.
Applications
Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa761-860 from MAGI1 (NP_004733) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MAGI1. Species Crossreactivity: rat.