Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Transcription Factors, Zinc (Ring) Finger » Anti -BAZ1A (Bromodomain Adjacent to Zinc Finger Domain Protein 1A, ATP-dependent Chromatin-remodeling Protein, ATP-utilizing Chromatin Assembly and Remodeling Factor 1, hACF1, CHRAC Subunit ACF1, Williams Syndrome Transcription Factor-related Chromatin-remodel

Anti -BAZ1A (Bromodomain Adjacent to Zinc Finger Domain Protein 1A, ATP-dependent
Chromatin-remodeling Protein, ATP-utilizing Chromatin Assembly and Remodeling Factor 1,
hACF1, CHRAC Subunit ACF1, Williams Syndrome Transcription Factor-related
Chromatin-remodel

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression.
Catalog #123843
ApplicationsSuitable for use in ELISA and Western Blot. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
AA Seqeuence LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI*
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG2a,k
Clone No1F6
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa1457-1557 from BAZ1A (NP_038476) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human BAZ1A.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links