Anti -BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell
CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9
Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B IH |
|
| BCL11A is a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. | | | Catalog # | 123880 | | Applications | Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. | | Recommended Dilution | Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml | | Optimal dilutions to be determined by the researcher. | | AA Sequence | MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 3D9 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Partial recombinant corresponding to aa1-89 from human BCL11A (NP_060484) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human BCL11A. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
Questions or comments about this product? Inquire here. |
|
|
Download Specifications for Anti -BCL11A (CTIP1, EVI9, KIAA1809, ZNF856, B Cell Lymphoma/Leukemia 11A, B Cell CLL/Lymphoma 11A, COUP-TF-interacting Protein 1, Ecotropic Viral Integration Site 9 Protein Homolog, Zinc Finger Protein 856, FLJ10173, FLJ34997, HBFQTL5) |
External Links
|
