CELSR3 is an Orphan-U GPCR with an unknown ligand. In mouse, this gene is expressed during development at sites of active neurogenesis and in adult mice and rats in brain, spinal cord, dorsal root ganglion, and eye. ESTs have been isolated from human B-cell/lung/testis, blood, brain, colon, heart/melanocyte/uterus, lung, nerve, and placenta libraries.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa71-180 from human CELSR3 (NP_001398) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CELSR3.