Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to DEAD Box Proteins » Anti -DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d)

Anti -DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box
Protein-Retinoblastoma DDX-1, UKVH5d)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Catalog #125721
ApplicationsSuitable for use in ELISA and Western Blot. Other applications not tested.
Recommended DilutionSandwich ELISA: The detection limit is ~10ng/ml as a capture antibody.
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG2b,k
Clone No4F6
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa642-740 from human DDX1 (NP_004930) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human DDX1.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links