Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to DEAD Box Proteins » Anti -DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems 3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3)

Anti -DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems
3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E IF
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which has an ATPase activity and is a component of the survival of motor neurons (SMN) complex. This protein interacts directly with SMN, the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on RNPs.
Catalog #125726
ApplicationsSuitable for use in Immunofluorescence and ELISA. Other applications not tested.
Recommended DilutionImmunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.
AA Sequence EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ*
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG2a,k
Clone No5H5
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa725-825 from DDX20 (NP_009135) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human DDX20.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links