Guanylyl cyclase C (GUCY2C) is a transmembrane receptor expressed primarily in the intestine that regulates chloride secretion via the cystic fibrosis transmembrane conductance regulator. Binding of GUCY2C to either the endogenous peptide guanylin or the bacterially derived heat-stable enterotoxin STa, results in increased levels of cGMP and the stimulation of water and chloride secretion. In the case of exposure to STa, this leads to debilitating secretory diarrhea.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa24-133 from human GUCY2C with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography
Specificity
Recognizes human GUCY2C