You are here:Home
»
Antibodies
»
Abs to Transcription Factors, Homeobox (HOX)
»
Anti -HOXD1 (Homeobox Protein Hox-D1, Homeobox Protein Hox-GG, HOX4, HOX4G)
Anti -HOXD1 (Homeobox Protein Hox-D1, Homeobox Protein Hox-GG, HOX4, HOX4G)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B IP |
|
| HOXD1 is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. | | | Catalog # | 128044 | | Applications | Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 4F4 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Partial recombinant corresponding to aa151-240 from human HOXD1 (NP_078777) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human HOXD1. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
