Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Binding Proteins » Anti -IGBP1 (IBP1, Immunoglobulin-binding Protein 1, B-cell Signal Transduction Molecule alpha 4, CD79a-binding Protein 1, Renal Carcinoma Antigen NY-REN-16)

Anti -IGBP1 (IBP1, Immunoglobulin-binding Protein 1, B-cell Signal Transduction Molecule
alpha 4, CD79a-binding Protein 1, Renal Carcinoma Antigen NY-REN-16)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E
The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways.
Catalog #128328
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Amino Acid Sequence RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG1,k
Clone No2B8
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa64-165 from human IGBP1 (NP_001542) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human IGBP1.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links