Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Enzymes, Protease (Proteinase, Peptidase) » Anti -LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)

Anti -LGMN (PRSC1, Legumain, Asparaginyl Endopeptidase, Protease, Cysteine 1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E
This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform.
Catalog #129076
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
AA SequenceMVWKVAVFLSVALGIGAIPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDHVFIYFTDHGS TGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPD
NINVYATTAANPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKET
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG1,k
Clone NoM1
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa1-434, from human LGMN (AAH03061) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human LGMN.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links