Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Netrin » Anti -LRRC4C (KIAA1580, NGL1, Leucine-rich Repeat-containing Protein 4C, Netrin-G1 Ligand))

Anti -LRRC4C (KIAA1580, NGL1, Leucine-rich Repeat-containing Protein 4C, Netrin-G1
Ligand))

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM].
Catalog #129216
ApplicationsSuitable for use in ELISA and Western Blot. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
AA Sequence AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
IsotypeIgG2a,k
Clone No1G5
HostMouse
SourceHuman
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2.
PurityPurified by Protein A affinity chromatography.
ImmunogenPartial recombinant corresponding to aa541-641 from human LRRC4C (NP_065980) with GST tag. MW of the GST tag alone is 26kD.
SpecificityRecognizes human LRRC4C.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links