Histone acetyltransferases (HATs) have been implicated in a number of cellular functions including gene regulation, DNA synthesis, and repair. Histone acetyltransferases and deacetylases are respectively, the enzymes devoted to thr addition and removal of acetyl groups from lysine residues on the Histone N-terminal trails. The enzymes exert fundamental roles in developmental processes and their deregulation has been linked to the progression of diverse human disorders, including cancer.
Applications
 Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
 Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
 ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
Storage and Stability
 May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa81-180 from MYST3 (NP_006757) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MYST3.