You are here:Home
»
Antibodies
»
Abs to Syntaxin, Synaptotagmin, Synaptophysin
»
Anti -PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit 6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA)
Anti -PLDN (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 6, BLOC-1 Subunit
6, Pallid Protein Homolog, Pallidin, Syntaxin 13-interacting Protein, BLOC1S6, PA)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B |
|
| The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. | | | Catalog # | 131445 | | Applications | Suitable for use in ELISA and Western Blot. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSML* | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 2H8 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Partial recombinant corresponding to aa1-100 from human PLDN (NP_036520) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human PLDN. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
