You are here:Home
»
Antibodies
»
Abs to Ion Transport
»
Anti -SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger 6, Na(+)/H(+) Exchanger 6, NHE6, NHE-6)
Anti -SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger
6, Na(+)/H(+) Exchanger 6, NHE6, NHE-6)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B |
|
| Catalog # | 133519 | | Applications | Suitable for use in Western Blot and ELISA. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | Clone Type | Monoclonal | | Isotype | IgG2a,k | | Clone No | 2D5 | | Host | Mouse | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified by Protein A affinity chromatography. | | Immunogen | Partial recombinant corresponding to aa602-669 from SLC9A6 (NP_006350) with GST tag. MW of the GST tag alone is 26kD. | | Specificity | Recognizes human SLC9A6. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
