Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-GFAP » GFAP, Blocking Protein (Glial Fibrillary Acidic Protein)

GFAP, Blocking Protein (Glial Fibrillary Acidic Protein)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Blocking Protein for G2032-27J.
Catalog #136900
Human GFAP is a 49.7kD protein (432aa) expressed in astrocytes. GFAP is an intermediate filament protein and acts as an intracellular structural component of the cytoskeleton. During embryonic and fetal life, GFAP is also expressed by radial glial cells of the CNS. Various mutations of the GFAP gene in humans produce Alexander's disease, one of the leukodystrophies. Antibodies to GFAP are therefore very useful as markers of astrocytic cells and neural stem cells. In addition many types of brain tumor, presumably derived from astrocytic cells, heavily express GFAP.
SourcePurified Bovine GFAP protein
AA SequenceMERRRVTSATRRSYVSSSEMVVGGRRLGPG TRLSLARMPP PLPARVDFSLAGALNSGFKETRASERAEMM ELNDRFASYI EKVRFLEQQN KALAAELNQLRAKEPTKLAD VYQAELRELR LRLDQLTANS ARLEVERDNL AQDLGTLRQK LQDETNQRLE AENNLAAYRQ EADEATLARLDLERKIESLE EEIRFLRKIH EEEVRELQEQ LAQQQVHVEM DVAKPDLTAALREIRTQYEA VASSNMHEAE EWYRSKFADL NDAAARNAELLRQAKHEAND YRRQLQALTC DLESLRGTNESLERQMREQE ERHAREAASY QEALARLEEE GQSLKDEMAR HLQEYQDLLN VKLALDIEIA TYRKLLEGEE NRITIPVQTF SNLQIRETSL DTKSVSEGHL KRNIVVKTVE MRDGEVIKESKQEHKDVM
Molecular Weight~49.5kD
ApplicationsSuitable for use in ELISA and Antibody Blocking. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight~49.5kD
SourceBovine protein
PuritySerum
Concentration~1mg/ml
FormSupplied as a liquid.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links