Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Ion Channel » Anti -ACCN3 (ASIC3, SLNAC1, TNAC1, Acid-sensing Ion Channel 3, Amiloride-sensitive Cation Channel 3, Neuronal Amiloride-sensitive Cation Channel 3, Testis Sodium Channel 1, DRASIC)

Anti -ACCN3 (ASIC3, SLNAC1, TNAC1, Acid-sensing Ion Channel 3, Amiloride-sensitive Cation
Channel 3, Neuronal Amiloride-sensitive Cation Channel 3, Testis Sodium Channel 1, DRASIC)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IH
ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.
Catalog #137514
ApplicationsSuitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended DilutionWestern Blot: 2.5ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenSynthetic peptide VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL corresponding to ACCN3.
SpecificityRecognizes human ACCN3.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links