Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Annexin » Anti -ANXA6 (Annexin A6, 67kD Calelectrin, Annexin VI, Annexin-6, Calphobindin-II, CPB-II, Chromobindin-20, Lipocortin VI, Protein III, p68, p70, ANX6)

Anti -ANXA6 (Annexin A6, 67kD Calelectrin, Annexin VI, Annexin-6, Calphobindin-II, CPB-II,
Chromobindin-20, Lipocortin VI, Protein III, p68, p70, ANX6)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B
Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60kbp long and contains 26 exons. It encodes a protein of about 68kD that consists of eight 68aa repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6aa insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Catalog #137548
ApplicationsSuitable for use in Western Blot. Other applications not tested.
Recommended DilutionWestern Blot: 1.25ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenC-terminus of ANXA6 corresponding to SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
SpecificityRecognizes human Annexin A6.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links