Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Cadherin » Anti -CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP)

Anti -CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IH
CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.
Catalog #137823
ApplicationsSuitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended DilutionWestern Blot: 1.25ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenSynthetic peptide corresponding to AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
SpecificityRecognizes CDH3. Species Crossreactivity: Human and mouse.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links