Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Enzymes, Sulfotransferase » Anti -CHST7 (Carbohydrate Sulfotransferase 7, Chondroitin 6-sulfotransferase 2, C6ST-2, GST-5, GlcNAc6ST-4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5, N-acetylglucosamine 6-O-sulfotransferase 4, Gn6st-4)

Anti -CHST7 (Carbohydrate Sulfotransferase 7, Chondroitin 6-sulfotransferase 2, C6ST-2,
GST-5, GlcNAc6ST-4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase
5, N-acetylglucosamine 6-O-sulfotransferase 4, Gn6st-4)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B
CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.
Catalog #137844
ApplicationsSuitable for use in Western Blot. Other applications not tested.
Recommended DilutionWestern Blot: 1.25ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenSynthetic peptide corresponding to a DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR
SpecificityRecognizes CHST7. Species Crossreactivity: Human, mouse and canine.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links