Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Nuclear Proteins » Anti -NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140, Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13, NS5ATP13)

Anti -NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar
Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140,
Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13,
NS5ATP13)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IH
Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.
Catalog #138185
ApplicationsSuitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended DilutionWestern Blot: 2.5ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenC-terminus of NOLC1 corresponding to DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
SpecificityRecognizes NOLC1. Species Crossreactivity: Human, mouse, rat, canine, Arabidopsis and drosophila.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links