Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Monocarboxylate Transporter » Anti -SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REMP)

Anti -SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8,

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IH
SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Catalog #138347
ApplicationsSuitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended DilutionWestern Blot: 2.5ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
FormSupplied as a lyophilized powder from PBS, 2% sucrose. Reconstitute with 100ul sterile ddH2O.
PurityPurified by Protein A affinity chromatography.
ImmunogenSynthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8.
SpecificityRecognizes human SLC16A8. Species crossreactivity: mouse, rat canine, zebrafish, bovine, guinea pig, equine, rabbit
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links