Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Transporters » Anti -SLC19A1 (Folate Transporter 1, FOLT, Intestinal Folate Carrier 1, IFC-1, Placental Folate Transporter, Reduced Folate Carrier Protein, RFC, Solute Carrier Family 19 Member 1, FLOT1, RFC1)

Anti -SLC19A1 (Folate Transporter 1, FOLT, Intestinal Folate Carrier 1, IFC-1, Placental
Folate Transporter, Reduced Folate Carrier Protein, RFC, Solute Carrier Family 19 Member
1, FLOT1, RFC1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IH
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.
Catalog #138348
ApplicationsSuitable for use in Western Blot and Immunohistochemistry. Other applications not tested.
Recommended DilutionWestern Blot: 5ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostRabbit
SourceHuman
Concentration~1mg/ml
FormSupplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.
PurityPurified by Protein A affinity chromatography.
ImmunogenSynthetic peptide corresponding to MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
SpecificityRecognizes human SLC19A1.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links