Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » Growth Factors-Interleukin » Interleukin-1-beta, Recombinant, Rat (IL-1 Beta, Catabolin, LAF, EP, LEM, MCF)

Interleukin-1-beta, Recombinant, Rat (IL-1 Beta, Catabolin, LAF, EP, LEM, MCF)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Interleukin-1 beta (IL-1b) is a pro-inflammatory cytokine, produced in response to inflammatory agents by a variety of cells, including, monocytes, macrophages, and dendritic cells (DCs). IL-1b and IL-1a are two distinct and independently regulated gene products that comprise IL-1 and signal through the Type 1 IL-1 receptor (IL-1R1). Although IL-1a is cell associated and IL-1b is secreted, they have nearly identical biological activity in that they induce adhesion molecule expression on epithelial cells, control fever induction, and play a role in arthritis and septic shock. Signaling activated by the IL-1R1 promotes these activities through a MYD88 signaling pathway similar to those associated with Toll receptors.
Catalog #142889
SourceRecombinant protein corresponding to 152aa from rat IL-1b expressed in E.coli.
Molecular Weight~17.3kD
Endotoxin 1EU/ug (LAL)
Biological ActivityThe activity is determined by the dose-dependent proliferation of mouse D10S cells and is typically <1ng/ml.
AA SequenceVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDG TPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~17.3kD
SourceE.coli
Purity~97% (HPLC, Reducing and non-reducing SDS-PAGE)
FormSupplied as a lyophilized powder in 10mM Na2PO4, pH 7.5. Reconstitute with sterile dH2O.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links