Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-Interleukin » Interleukin 17E, Recombinant, Mouse (IL-17E, IL-25)

Interleukin 17E, Recombinant, Mouse (IL-17E, IL-25)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-kB by binding to the receptor IL-17RB.
Catalog #142908
SourceRecombinant protein corresponding to two 145aa chians from mouse IL-17E expressed in E.coli.
Molecular Weight~35.5kD
Endotoxin 1EU/ug (LAL)
Biological ActivityThe activity is determined by the dose-dependant production of IL-8 from cultured human PBMCs and is typically 10-100ng/ml.
AA SequenceVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVP QDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~35.5kD
SourceE.coli
Purity~95% (HPLC, Reducing and non-reducing SDS-PAGE)
FormSupplied as a lyophilized powder. No additives. Reconstitute with sterile 10mM hydrochloride.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links