You are here:Home
»
Molecular Biology
»
Growth Factors-Interleukin
»
IL-13 (113 a.a.), Recombinant, Rat (NC300 (Human) P600 (Murine))
IL-13 (113 a.a.), Recombinant, Rat (NC300 (Human) P600 (Murine))
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells.Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites.IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8.IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE.Blocking of IL-13 activity inhibits the pathophysiology of asthma.Human and murine IL-13 is cross-species reactive.Recombinant rat IL-13 is a 12.3kD protein consisting of 113 amino acid residues. | | | Catalog # | 143384 | | Biological Activity | The ED50 was determined by the dose-dependent proliferation of TF-1 cells is ~5.0ng/ml, corresponding to a specific activity of ~2x10e5 units/mg. | | AA Sequence | TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH | | Crossreactivity | Human | | Quality Control | Verified by N-terminal and Mass Spectrometry analyses (when applicable). | | Endotoxin | <0.1ng/ug of protein (<1EU/ug). | | Protein Content | Verified by UV Spectroscopy and/or SDS-PAGE gel. | | Storage and Stability | Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | | Source | E. coli | | Purity | 98% by SDS-PAGE gel and HPLC analyses. | | Form | Supplied as a lyophilized powder. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
