USBio Logo

143384 IL-13 (113 a.a.), Recombinant, Rat (NC300 (Human) P600 (Murine)) CAS:

Specifications
Grade
Highly Purified
Swiss Prot
P42203
EU Commodity Code
30021019
Shipping Temp
Blue Ice
Storage Temp
-20°C

IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells.Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites.IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8.IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE.Blocking of IL-13 activity inhibits the pathophysiology of asthma.Human and murine IL-13 is cross-species reactive.Recombinant rat IL-13 is a 12.3kD protein consisting of 113 amino acid residues.

Biological Activity
The ED50 was determined by the dose-dependent proliferation of TF-1 cells is ≤5.0ng/ml, corresponding to a specific activity of ≥2x10e5 units/mg.
Amino Acid Sequence
TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder. Reconstitute with sterile ddH2O to a concentration of 0.1-1.0mg/ml. Do not vortex. For long term add protein carrier. It is recommended that further dilutions be made into other aqueous buffers.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved