You are here:Home
»
Antibodies
»
Abs to Transcription Factors
»
Anti -Activating Transcription Factor 4 (ATF 4, ATF4 Protein, Cyclic AMP-dependent Transcription Factor ATF-4, Cyclic AMP-responsive Element Binding Protein 2, CREB2, CREB-2, DNA Binding Protein TAXREB67, Tax-responsive Enhancer Element B67, TAXREB67, TXREB)
Anti -Activating Transcription Factor 4 (ATF 4, ATF4 Protein, Cyclic AMP-dependent
Transcription Factor ATF-4, Cyclic AMP-responsive Element Binding Protein 2, CREB2,
CREB-2, DNA Binding Protein TAXREB67, Tax-responsive Enhancer Element B67, TAXREB67,
TXREB)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Purified |
E B IF |
|
| This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. | | | Catalog # | A0855-69F | | Applications | Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | AA Sequence | SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | CAS Number | n/a | | Clone Type | Monoclonal | | Isotype | IgG1, k | | Clone No | 2B3 | | Host | Mouse | | Source | Human | | Concentration | ~0.5mg/ml | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified | | Immunogen | Partial recombinant protein corresponding to aa171-270, of human ATF4 with GST tag (NP_001666). MW of the GST tag alone is 26kD. | | Specificity | Recognizes human ATF4. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
