You are here:Home
»
Antibodies
»
Abs to Activin
»
Anti -Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC)
Anti -Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Affinity Purified |
E B IH |
|
| Catalog # | A0855-93H | | Applications | Suitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot. Other applications not tested. | | Recommended Dilution | Western Blot: 1:5,000 | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Monoclonal | | Isotype | IgG1 | | Clone No | 10B48 | | Host | Mouse | | Source | Human | | Concentration | ~0.5mg/ml | | Form | Supplied as a liquid in PBS, 0.09% sodium azide. | | Purity | Purified by Protein G affinity chromatography. | | Immunogen | Synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit. | | Specificity | Recognizes human Activin B. Species Crossreactivity: rat. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|