Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Activin » Anti -Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC)

Anti -Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC)

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B IH
Catalog #A0855-93H1
ApplicationsSuitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot. Other applications not tested.
Recommended DilutionWestern Blot: 1:5,000
Optimal dilutions to be determined by the researcher.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypeMonoclonal
Clone No10B49
FormSupplied as a liquid in PBS, 0.09% sodium azide.
PurityPurified by Protein G affinity chromatography.
ImmunogenSynthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit.
SpecificityRecognizes human Activin B. Species Crossreactivity: rat.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links