
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Obesity Proteins » Anti -AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)

Anti -AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Guinea pig Serum IH
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Catalog #A1059-62J
Applications Suitable for use in Immunohistochemistry. Other applications not tested.
Recommended DilutionImmunohistochemistry (Frozen): 1:1000- :2000
Optimal dilution determined by the researcher.
Positive ControlSheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP.
Storage and Stability:
Lyophilized powder may be stored at -20°C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
HostGuinea pig
FormSupplied as a lyophilized powder. Reconstitute with 50ul sterile 40-50% glycerol, PBS.
ImmunogenSynthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
SpecificityRecognizes AGRP. Species crossreactivity: sheep.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links