You are here:Home
»
Antibodies
»
Abs to Obesity Proteins
»
Anti -AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
Anti -AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Guinea pig |
Serum |
IH |
|
| AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats. | | | Catalog # | A1059-62J | | Applications Suitable for use in Immunohistochemistry. Other applications not tested. | | Recommended Dilution | Immunohistochemistry (Frozen): 1:1000- :2000 | | Optimal dilution determined by the researcher. | | Positive Control | Sheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. | | | | Storage and Stability: | | Lyophilized powder may be stored at -20°C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Guinea pig | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder. Reconstitute with 50ul sterile 40-50% glycerol, PBS. | | Purity | Serum | | Immunogen | Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein. | | Specificity | Recognizes AGRP. Species crossreactivity: sheep. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
