
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Neuroscience » Anti -Amylin

Anti -Amylin


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Rabbit Serum IH
Catalog #A2275-52H
ApplicationsSuitable for use in Immunohistochemistry. Other applications not tested.
Recommended DilutionImmunohistochemistry (formalin-fixed paraffin): 1:200 (ABC, DAB). Boil tissue sections in 10mM citrate buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min.
Optimal dilutions to be determined by the researcher.
Positive ControlHuman Pancreas tissue
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
ConcentrationNot determined
FormSupplied as a lyophilized powder. Reconstitute with sterile dH2O.
ImmunogenSynthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2)
SpecificityRecognizes human Amylin.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links