You are here:Home
»
Antibodies
»
Abs to Neuroscience
»
Anti -Amylin
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Rabbit |
Serum |
IH |
|
| Catalog # | A2275-52H | | Applications | Suitable for use in Immunohistochemistry. Other applications not tested. | | Recommended Dilution | Immunohistochemistry (formalin-fixed paraffin): 1:200 (ABC, DAB). Boil tissue sections in 10mM citrate buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min. | | Optimal dilutions to be determined by the researcher. | | Positive Control | Human Pancreas tissue | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Rabbit | | Source | Human | | Concentration | Not determined | | Form | Supplied as a lyophilized powder. Reconstitute with sterile dH2O. | | Purity | Serum | | Immunogen | Synthetic peptide corresponding to human Amylin (KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2) | | Specificity | Recognizes human Amylin. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|