
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » MB-Amyloid » -Amyloid, Human (Amyloid beta)

-Amyloid, Human (Amyloid beta)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Synthetic peptide aa672-711 corresponding to fulllength human beta amyloid 40, a major component of amyloid plaques, DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV.
Catalog #A2275-73H
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
SourceSynthetic peptide
Purity~72% protein by aa analysis.. 98% by HPLC
ConcentrationAs reported
FormSupplied as a lyophilized powder. Reconstitute in 1ml dH2O. Recommend the vial is gently mixed after reconstitution.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links