You are here:Home
»
Antibodies
»
Abs to Hormones, Steroids
»
Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)
Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting
Substance, MIS)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Monoclonal |
Mouse |
Supernatant |
B IH |
|
| Anti-mullerian hormone (AMH) is originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. | | | Catalog # | A2298-11M | | Applications | Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested. | | Recommended Dilution | Immunohistochemistry (paraffin): 1:20-1:40 Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended. | | Optimal dilutions to be determined by the researcher. | | Positive Control Tissue | Ovary | | Hybridoma | Sp2/0 myeloma cells with spleen cells from T/O outbred mice. | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | CAS Number | n/a | | Clone Type | Monoclonal | | Isotype | IgG1 | | Clone No | 10B151 | | Host | Mouse | | Source | Human | | Concentration | Not determined | | Form | Supplied as a liquid in PBS, 0.09% sodium azide. | | Purity | Supernatant | | Immunogen | Synthetic peptide corresponding to human Anti-Mullerian Hormone (VPTAYAGKLLISLSEERISAHHVPNMVATEC). | | Specificity | Recognizes human Anti-Mullerian Hormone. Species Crossreactivity: mouse, sheep, monkey | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
