
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Hormones, Steroids » Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)

Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting
Substance, MIS)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Monoclonal Mouse Supernatant B IH
Anti-mullerian hormone (AMH) is originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulfide linked precursor that is cleaved to release the mature 30kD homodimer.
Catalog #A2298-11M
ApplicationsSuitable for use in Immunohistochemistry and Western Blot. Other applications not tested.
Recommended DilutionsImmunohistochemistry (Paraffin): 1:20-1:40, Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended.
Optimal dilutions to be determined by the researcher.
Positive Control TissueOvary
HybridomaSp2/0 myeloma cells with spleen cells from T/O outbred mice.
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypeMonoclonal
Clone No10B151
ConcentrationNot determined
FormSupplied as a liquid, 0.1% sodium azide.
ImmunogenSynthetic peptide corresponding to human Anti-Mullerian Hormone (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
SpecificityRecognizes human Anti-Mullerian Hormone.
Species CrossreactivityMouse, sheep, Squirrel monkey and baboon.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links