Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Apoptosis » Anti -Apaf-1 (Apoptosis Protease Activating Factor 1)

Anti -Apaf-1 (Apoptosis Protease Activating Factor 1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Chicken Affinity Purified B
Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. The mammalian homolog of the key cell death gene CED 4 in C. elegans was identified recently from human and mouse and designated APAF1 for Apoptosis protease activating factor 1. APAF1 binds to Cytochrome c (APAF2) and Caspase 9 (APAF3), which leads to Caspase 9 activation. Activated Caspase 9 in turn cleaves and activates Caspase 3 that is one of the key proteases, being responsible for the proteolytic cleavage of many key proteins in apoptosis. APAF1 can also associate with Caspase 4 and Caspase 8. APAF1 transcript is ubiquitously expressed in human tissues.
Catalog #A2298-64Y
ApplicationsSuitable for use in Western Blot.. Other applications not tested.
Recommended DilutionWestern Blot: 1:500 detects a a band at ~139kD.
Optimal dilutions to be determined by the researcher.
Recommended Secondary Antibodies I1906 IgY, Chicken Pab Rb x Ch I1906-10 IgY, Chicken (HRP) Rb x Ch I1906-12 IgY, Chicken (FITC) Rb x Ch I1906-14 IgY, Chicken (AP) Rb x Ch
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
CAS Numbern/a
Clone TypePolyclonal
IsotypeIgY
HostChicken
SourceHuman
Concentration~1mg/ml
FormSupplied as a liquid in PBS, pH 7.2. No preservative added.
PurityPurified by immunoaffinity chromatography.
ImmunogenSynthetic peptide corresponding to aa 307-388, PEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSI from human APAF1.
SpecificityRecognizes human Apaf-1. Species Crossreactivity: mouse.
Species sequence homologyRat 93%
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Alternate namesCED4, KIAA0413


External Links