You are here:Home
»
Antibodies
»
Abs to Apoptosis
»
Anti -Apaf-1 (Apoptosis Protease Activating Factor 1)
Anti -Apaf-1 (Apoptosis Protease Activating Factor 1)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Chicken |
Affinity Purified |
B |
|
| Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases. The mammalian homolog of the key cell death gene CED 4 in C. elegans was identified recently from human and mouse and designated APAF1 for Apoptosis protease activating factor 1. APAF1 binds to Cytochrome c (APAF2) and Caspase 9 (APAF3), which leads to Caspase 9 activation. Activated Caspase 9 in turn cleaves and activates Caspase 3 that is one of the key proteases, being responsible for the proteolytic cleavage of many key proteins in apoptosis. APAF1 can also associate with Caspase 4 and Caspase 8. APAF1 transcript is ubiquitously expressed in human tissues. | | | Catalog # | A2298-64Y | | Applications | Suitable for use in Western Blot.. Other applications not tested. | | Recommended Dilution | Western Blot: 1:500 detects a a band at ~139kD. | | Optimal dilutions to be determined by the researcher. | | Recommended Secondary Antibodies | I1906 IgY, Chicken Pab Rb x Ch I1906-10 IgY, Chicken (HRP) Rb x Ch I1906-12 IgY, Chicken (FITC) Rb x Ch I1906-14 IgY, Chicken (AP) Rb x Ch | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgY | | Host | Chicken | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a liquid in PBS, pH 7.2. No preservative added. | | Purity | Purified by immunoaffinity chromatography. | | Immunogen | Synthetic peptide corresponding to aa 307-388, PEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSI from human APAF1. | | Specificity | Recognizes human Apaf-1. Species Crossreactivity: mouse. | | Species sequence homology | Rat 93% | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. | | Alternate names | CED4, KIAA0413 |
External Links
|
