Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Cardiac Markers » Anti -Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin, Cardiodilatin-related peptide)

Anti -Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor,
Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND,
Prepronatriodilatin, Cardiodilatin-related peptide)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Sheep Serum
Catalog #A4153-03
ApplicationsSuitable for use in ELISA, RIA. Other applications not tested.
Recommended DilutionRIA: 1:5000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Numbern/a
Clone TypePolyclonal
HostSheep
SourceHuman
Concentration~1mg/ml
FormSupplied as a lyophilized powder. Reconstitute with sterile dH2O.
PuritySerum
ImmunogenSynthetic human pro-ANP (aa 1-30) polylysine conjugated
(NPMYNAVSNADLMDFKNLLDHLEEKMPLED)
SpecificityRecognizes synthetic human pro-Atrial Natriuretic Peptide (aa 1-30). There were no cross reactivities obtained with human pro-ANP.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Alternate namesANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin


External Links