Anti -Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor,
Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND,
Prepronatriodilatin, Cardiodilatin-related peptide)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Sheep |
Serum |
|
|
| Catalog # | A4153-03 | | Applications | Suitable for use in ELISA, RIA. Other applications not tested. | | Recommended Dilution | RIA: 1:5000 | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Host | Sheep | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder. Reconstitute with sterile dH2O. | | Purity | Serum | | Immunogen | Synthetic human pro-ANP (aa 1-30) polylysine conjugated | | (NPMYNAVSNADLMDFKNLLDHLEEKMPLED) | | Specificity | Recognizes synthetic human pro-Atrial Natriuretic Peptide (aa 1-30). There were no cross reactivities obtained with human pro-ANP. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. | | Alternate names | ANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin |
|
|
Questions or comments about this product? Inquire here. |
|
|
Download Specifications for Anti -Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin, Cardiodilatin-related peptide) |
External Links
|
