Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications Monoclonal Mouse Affinity Purified E B

Catalog #	B0899-03G
Applications	Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution	Western Blotting: 1:1000-1:2000
	Optimal dilutions to be determined by the researcher.
Storage and Stability	Lyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Number	n/a
Clone Type	Monoclonal
Isotype	IgG1
Clone No	M4-14b-H4
Host	Mouse
Source	Human
Concentration	~1mg/ml
Form	Supplied as a lyophilized powder in 50mM Tris, pH 7.4.
Purity	Purified from cell culture supernatant by Protein G affinity chromatography
Immunogen	Synthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Specificity	Recognizes human ß-Defensin 1 (epitope: aa 1-36)
Important Note	This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.