
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Defensin » Anti -BD1, aa1-36 (beta Defensin-1)

Anti -BD1, aa1-36 (beta Defensin-1)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E B
Catalog #B0899-03G
ApplicationsSuitable for use in ELISA and Western Blot. Other applications not tested.
Recommended DilutionWestern Blotting: 1:1000-1:2000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypeMonoclonal
Clone NoM4-14b-H4
FormSupplied as a lyophilized powder in 50mM Tris, pH 7.4.
PurityPurified from cell culture supernatant by Protein G affinity chromatography
ImmunogenSynthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
SpecificityRecognizes human ß-Defensin 1 (epitope: aa 1-36)
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links