
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » MB-Growth Factors-Defensin » BD1, aa1-36, Control Peptide (beta Defensin-1)

BD1, aa1-36, Control Peptide (beta Defensin-1)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Control Peptide for B0899-04, BD1, aa1-36 (beta Defensin-1).
Catalog #B0899-04A
Synthetic peptide corresponding to aa1-36, DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK, beta-Defensin 1 peptide.
ApplicationsSuitable for use in ELISA and Antibody Blocking. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Reconstitute with 0.1% acetic acid for required concentration. Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Purity~95% (HPLC)
FormSupplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links