You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Defensin
»
BD1, aa1-36, Control Peptide (beta Defensin-1)
BD1, aa1-36, Control Peptide (beta Defensin-1)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Control Peptide for B0899-04, BD1, aa1-36 (beta Defensin-1). | | | Catalog # | B0899-04A | | Source | | | Synthetic peptide corresponding to aa1-36, DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK, beta-Defensin 1 peptide. | | Applications | Suitable for use in ELISA and Antibody Blocking. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstitute with 0.1% acetic acid for required concentration. Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Source | Synthetic | | Purity | ~95% (HPLC) | | Form | Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
