You are here:Home
»
Antibodies
»
Abs to Defensin
»
Anti -BD2, aa4-41 (beta Defensin-2)
Anti -BD2, aa4-41 (beta Defensin-2)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Sheep |
Serum |
E |
|
| Catalog # | B0901-01C | | Applications | Suitable for use in ELISA. Other applications not tested. | | Recommended Dilution | ELISA: 1:5000 | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Host | Sheep | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O. | | Purity | Serum | | Immunogen | Synthetic human -Defensin 2 (aa 4-41) | | (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) | | Specificity | Recognizes human beta-Defensin 2 (epitope: aa 4-41) | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|