Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Defensin » Anti -BD2, aa4-41 (beta Defensin-2)

Anti -BD2, aa4-41 (beta Defensin-2)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Sheep Serum E
Catalog #B0901-01C
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionELISA: 1:5000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Numbern/a
Clone TypePolyclonal
HostSheep
SourceHuman
Concentration~1mg/ml
FormSupplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
PuritySerum
ImmunogenSynthetic human -Defensin 2 (aa 4-41)
(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
SpecificityRecognizes human beta-Defensin 2 (epitope: aa 4-41)
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links