You are here:Home
»
BioSeparation?
»
BioSep-Assay Detection, Tags
»
Blue Fluorescent Protein, Recombinant (BFP)
Blue Fluorescent Protein, Recombinant (BFP)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29kD monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The | | | protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. | | | Catalog # | B2174-90 | | Application(s) | BFP is suitable as a control reagent for BFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of BFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of BFP into cells and tissues, etc. The recombinant BFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP, YFP, or any other dyes. The 6XHis-Tag on the N-terminal can be used in Western blot detection with 6XHis-tag antibodies. The 6XHis-tag can also be used in removal or purification of the BFP. | | BFP protein sequence | MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY | | GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF | | FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN | | GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV | | LLEFVTAAGITLGMDELYK | | Endotoxin | 0.1ng/ug | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot and store at -70°C. Reconstituted product is stable for 6 months at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Source | E. coli | | Purity | 97% by SDS-PAGE and HPLC | | Form | Supplied as a lyophilized powder. Reconstitute with 100ul dH2O. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|