Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » BioSeparation? » BioSep-Assay Detection, Tags » Blue Fluorescent Protein, Recombinant (BFP)

Blue Fluorescent Protein, Recombinant (BFP)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29kD monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The
protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads.
Catalog #B2174-90
Application(s) BFP is suitable as a control reagent for BFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of BFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of BFP into cells and tissues, etc. The recombinant BFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP, YFP, or any other dyes. The 6XHis-Tag on the N-terminal can be used in Western blot detection with 6XHis-tag antibodies. The 6XHis-tag can also be used in removal or purification of the BFP.
BFP protein sequenceMGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY
GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV
LLEFVTAAGITLGMDELYK
Endotoxin 0.1ng/ug
Storage and StabilityLyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot and store at -70°C. Reconstituted product is stable for 6 months at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
SourceE. coli
Purity97% by SDS-PAGE and HPLC
FormSupplied as a lyophilized powder. Reconstitute with 100ul dH2O.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links