Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » MB-Peptides » Brain Natriuretic Peptide, Pro, aa1-108, Recombinant, Human (proBNP, Prohormone brain natriuretic peptide)

Brain Natriuretic Peptide, Pro, aa1-108, Recombinant, Human (proBNP, Prohormone brain
natriuretic peptide)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134aa precursor (prepro-BNP), which is cleaved by proteases to form a 26aa "signal" peptide and a 108aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76aa amino-terminal NT-proBNP and biologically active 32aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early diagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.
Catalog #B2702-03C
SourceRecombinant human pro-Brain Natriuretic peptide, expressed in E. coli.
AA SequenceGRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM
Molecular Weight~12.18kD
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight12.18kD
SourceE. coli
Purity95% pure (SDS-PAGE).
FormSupplied as a lyophilized powder from 200mM ammonium acetate, pH 7.0. No preservatives added. Reconstitute with 10ul sterile ddH2O.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links