You are here:Home
»
Molecular Biology
»
MB-Hormones, Steroids
»
BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)
BNP, Human (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide, NPPB)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H2O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32aa and having a molecular mass of 3464D. | | | Catalog # | B2702-30A | | AA Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH | | Molecular Weight | ~3.464kD | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~3.464kD | | Source | Synthetic peptide | | Purity | ~98% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder. Reconstitute with sterile ddH2O to 100ug/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
