Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » MB-Hormones, Steroids » Brain Natriuretic Peptide, Human (Brain Natriuretic Peptide 32, BNP 32, Gamma Brain Natriuretic Peptide, Natriuretic Peptide Brain Type, Natriuretic Peptide Precursor B, Natriuretic Peptides B, NPPB Protein)

Brain Natriuretic Peptide, Human (Brain Natriuretic Peptide 32, BNP 32, Gamma Brain
Natriuretic Peptide, Natriuretic Peptide Brain Type, Natriuretic Peptide Precursor B,
Natriuretic Peptides B, NPPB Protein)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Catalog #B2702-30B
SourceSynthetic peptide corresponding to SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH of synthetic human brain natriuretic peptide
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityStore at -20oC only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use.
SourceSynthetic peptide
Purity~98.0% (HPLC) analysis
FormSupplied as a liquid in TFA salt.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links