Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Peptides » Anti -Brain Natriuretic Peptide, aa1-32 (BNP)

Anti -Brain Natriuretic Peptide, aa1-32 (BNP)

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified E
Human brain natriuretic peptide (BNP) is a secreted protein which is a member of the natriuretic peptide family. BNP is a cardiac hormone, which is synthesized as a pro-hormone (proBNP), and is proteolytically cleaved to release a biologically active fragment (BNP), and an inactive fragment (NT-proBNP) into the circulation.
Catalog #B2702-33E
BNP is predominantly secreted from the cardiac ventricles in response to volume and pressure overload, and results in a number of biological activities including natriuresis, diuresis, vasorelaxation, and inhibition of the sympathetic nervous system. A high concentration of BNP in the bloodstream is indicative of heart failure.
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypeMonoclonal
Clone No17-16
FormSupplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
PurityPurified by Protein G affinity chromatography.
ImmunogenSynthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
SpecificityRecognizes synthetic human Brain Natriuretic Peptide (aa 1-32)
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links