You are here:Home
»
Molecular Biology
»
MB-Complement
»
Complement C5a, Recombinant Mouse
Complement C5a, Recombinant Mouse
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. | | | Catalog # | C0012-03 | | Recombinant corresponding to mouse C5a (6xHIS tag) expressed in E. coli. | | Amino Acid Sequence | MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERV | | ARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | 12kD | | Source | E.coli | | Concentration | ~0.1mg/ml (after reconstitution) | | Form | Supplied as a lyophilized powder from PBS. Reconstitute with 500ul sterile ddH2O. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|