
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Calcitonin » Anti -Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2)

Anti -Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Goat Serum RIA
Catalog #C0115-03
ApplicationsSuitable for use in RIA. Other applications not tested.
Recommended DilutionRIA: 1:3000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
FormSupplied as a lyophilized powder in PBS, pH 7.2. Reconstitute with sterile dH2O.
ImmunogenSynthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF)
SpecificityRecognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links