You are here:Home
»
Antibodies
»
Abs to Calcitonin
»
Anti -Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2)
Anti -Calcitonin-Gene related Peptide 2 (CGRP-II, Beta-ype CGRP, CALCB, CALC2)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Goat |
Serum |
RIA |
|
| Catalog # | C0115-03 | | Applications | Suitable for use in RIA. Other applications not tested. | | Recommended Dilution | RIA: 1:3000 | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Host | Goat | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute with sterile dH2O. | | Purity | Serum | | Immunogen | Synthetic human Calcitonin Gene-related Peptide, bTG- conjugated (ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF) | | Specificity | Recognizes human Calcitonin-Gene related Peptide 2. There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|